PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn285781
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family WOX
Protein Properties Length: 226aa    MW: 24797.7 Da    PI: 9.0685
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn285781genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.8e-212079357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq+  Le+l+++  r+p+ae++++++++l    +++ ++V++WFqN++a++k+
  Achn285781 20 SRWNPTKEQISMLENLYKQgIRTPTAEQIQQITSRLqafgHIEGKNVFYWFQNHKARQKQ 79
                8*****************99**************************************97 PP

2Wus_type_Homeobox115.23.1e-371881265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi +Le+lyk+G+rtP++e+iq+it++L+++G+ie+kNVfyWFQN+kaR++qkq
         Achn285781 18 SSSRWNPTKEQISMLENLYKQGIRTPTAEQIQQITSRLQAFGHIEGKNVFYWFQNHKARQKQKQ 81
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2891580IPR001356Homeobox domain
SuperFamilySSF466891.33E-131687IPR009057Homeodomain-like
SMARTSM003895.5E-61784IPR001356Homeobox domain
PfamPF000468.5E-192079IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-92080IPR009057Homeodomain-like
CDDcd000861.91E-62176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEGESAAVGS DSVGGAPSSS RWNPTKEQIS MLENLYKQGI RTPTAEQIQQ ITSRLQAFGH  60
IEGKNVFYWF QNHKARQKQK QKQESLAFVS RFLSPPPFPN VVCGPYYLPQ SEYGFYPQCP  120
NKVLLQGGVK RIPRPNRIET TRPCSGAGYA SAHHNITTKY SKQETLSLFP LEPTGILQAK  180
TTMTSPSIST NPSSSSETTT AIDELGSSDQ PFFDFFSGNG FSSSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016457.13e-81WUSCHEL related homeobox 2, putative
SwissprotQ6X7K11e-50WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A061GX694e-81A0A061GX69_THECC; WUSCHEL related homeobox 2, putative
STRINGGLYMA11G14940.24e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-47WUSCHEL related homeobox 2